Sermorelin
Product Name: Sermorelin
CAS No.: 86168-78-7
Synonym: GRF (1-29), GHRH (1-29) amide, Geref
Document Version: V1.0
Application Scope: For Laboratory Research Only
Release Date: 2026
1. Basic Chemical Information
Test Item | Specification |
|---|
Full Name | Sermorelin |
Chemical Name | Growth Hormone-Releasing Factor Fragment 1-29 Amide (Human) |
Molecular Formula | C₁₄₉H₂₄₆N₄₄O₄₂S |
Molecular Weight | 3357.88 Da (free base) |
1-Letter Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ |
3-Letter Sequence | H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ |
Peptide Structure | Linear 29-amino-acid polypeptide, C-terminal amidated, synthetic GHRH analog |
Target Receptor | GHRH Receptor |
Biological Function | Sermorelin is a truncated synthetic analog of growth hormone-releasing hormone. It effectively stimulates pituitary growth hormone secretion, regulates GH/IGF‑1 axis metabolism, and is widely used in endocrinology, growth regulation and metabolic mechanism research. |
2. Physical Characteristics
Appearance: White to off-white lyophilized crystalline powder
Odor: Odorless
Solubility: Freely soluble in sterile purified water and neutral PBS buffer (pH 6.5–8.0); soluble in DMSO; insoluble in non-polar organic solvents
Aqueous Solution pH (1 mg/mL): 6.0 – 8.0
Hygroscopicity: Moderately hygroscopic. Keep tightly sealed, dry and dark, avoid long-term air exposure and high humidity
3. Quality Specifications
Test Item | Test Method | Standard Specification |
|---|
Identity | RP-HPLC, ESI-MS | Match with standard reference; MW tolerance ±2 Da |
Purity (HPLC Area) | RP-HPLC | ≥99.0% |
Maximum Single Impurity | RP-HPLC | ≤0.50% |
Total Impurities | RP-HPLC | ≤2.0% |
Peptide Assay Content | HPLC / Titration | 98.0% – 102.0% |
Water Content | Karl Fischer | ≤1.0% |
Residual TFA/Acetate | Ion Chromatography | ≤0.5% |
Endotoxin | LAL Test (USP <85>) | ≤10 EU/mg |
Heavy Metals | ICP-MS | Pb,As,Cd,Hg ≤10 ppm each |
Residual Organic Solvents | GC | Compliant with ICH Q3C standard |
Amino Acid Composition | Amino Acid Analyzer | Within ±10% theoretical value |
4. Storage & Stability Conditions
4.1 Lyophilized Powder (Original Package)
Long-term Storage: ≤ -80℃, sealed, dry and dark environment, shelf life: 24 months
Medium-term Storage: -20℃, sealed and desiccated, shelf life: 12 months
Note: Avoid repeated freezing and thawing cycles
4.2 Reconstituted Aqueous Solution
5. Stock Solution Preparation
Molecular Weight: 3357.88 Da
1 mM Standard Solution: Weigh 3.358 mg Sermorelin powder, dissolve in 1 mL sterile purified water or PBS buffer
Recommended Solvent: Sterile purified water / pH 7.0-7.4 PBS buffer
Operation Tip: Gentle dissolution and fresh preparation are recommended to maintain biological activity for endocrine research assays.
6. Safety Handling & Disclaimer
This synthetic long-chain polypeptide is slightly irritant to eyes, skin and respiratory mucosa.
Wear standard PPE: lab coat, nitrile gloves, safety goggles during operation.
Avoid inhalation of powder dust and direct skin contact.
Waste materials shall be disposed in accordance with local chemical waste management regulations.
Strict Disclaimer: This product is only for scientific laboratory research. Not for human clinical use, medication or veterinary application.
7. HPLC Analytical Test Conditions
Column: C18 Analytical Column (250×4.6mm, 5μm)
Mobile Phase A: 0.1% TFA in Water
Mobile Phase B: 0.1% TFA in Acetonitrile
Detection Wavelength: 220 nm / 280 nm
Flow Rate: 1.0 mL/min
Column Temperature: 30℃
8. Analytical Spectrum Characterization
8.1 RP-HPLC Chromatogram
Sharp, symmetric main peak with qualified impurity distribution. Batch-specific HPLC chromatogram is available for customer verification upon request.
8.2 NMR Spectroscopy (¹H-NMR / ¹³C-NMR)
Test solvent: D₂O / DMSO-d₆, 400–500 MHz. Characteristic chemical shifts match the full 29-amino-acid sequence structure of Sermorelin (GRF 1-29). Official NMR report can be provided for bulk orders.
8.3 ESI-MS Identity Confirmation
Theoretical molecular weight: 3357.88 Da; Expected quasi-molecular ion [M+H]⁺ = 3358.88 Da, mass tolerance ±2 Da, consistent with target structural identity.
End of Document
